Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL16 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 16

Gene Aliases

C-C motif chemokine 16; chemokine (C-C motif) ligand 16; Chemokine CC-4; chemokine LEC; CKb12; HCC-4; IL-10-inducible chemokine; ILINCK; LCC-1; LEC; liver CC chemokine-1; liver-expressed chemokine; LMC; lymphocyte and monocyte chemoattractant; monotactin-1; Mtn-1; NCC4; NCC-4; new CC chemokine 4; SCYA16; SCYL4; small inducible cytokine subfamily A (Cys-Cys), member 16; small-inducible cytokine A16.

Gene ID

6360

Accession Number

NP_004581

Reactivity

Homo sapiens|Human

Target

Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

Type

Protein

Source

E.coli

Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCL16

Protein Name

C-C motif chemokine 16

Gene Name URL

CCL16

Nucleotide Accession Number

NM_004590

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio Neural cell adhesion molecule L1.2 (nadl1.2), partial
MBS1428093 Inquire

Recombinant Danio rerio Neural cell adhesion molecule L1.2 (nadl1.2), partial

Sign In for Pricing
View Details
IER3IP1 AAV Vector (Mouse) (CMV)
24203104 1 µg

IER3IP1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ENTPD7 Antibody - C-terminal region : Biotin (ARP49493_P050-Biotin)
ARP49493_P050-Biotin 100 µL

ENTPD7 Antibody - C-terminal region : Biotin (ARP49493_P050-Biotin)

Sign In for Pricing
View Details
Recombinant Chromohalobacter salexigens Protein hfq (hfq)
MBS1387930-01 0.02 mg (E-Coli)

Recombinant Chromohalobacter salexigens Protein hfq (hfq)

Sign In for Pricing
View Details
Recombinant Chromohalobacter salexigens Protein hfq (hfq)
MBS1387930-02 0.1 mg (E-Coli)

Recombinant Chromohalobacter salexigens Protein hfq (hfq)

Sign In for Pricing
View Details
Recombinant Chromohalobacter salexigens Protein hfq (hfq)
MBS1387930-03 0.02 mg (Yeast)

Recombinant Chromohalobacter salexigens Protein hfq (hfq)

Sign In for Pricing
View Details