Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP14 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Caspase 14

Gene Aliases

Apoptosis-related cysteine protease; ARCI12; CASP-14; caspase 14, apoptosis-related cysteine peptidase; caspase 14, apoptosis-related cysteine protease; caspase-14.

Gene ID

23581

Accession Number

NP_036246

Reactivity

Homo sapiens|Human

Target

Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum (PubMed:15556625) . Seems to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin (By similarity) . In vitro has a preference for the substrate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF (PubMed:16854378, PubMed:19960512) . Involved in processing of prosaposin in the epidermis (By similarity) . May be involved in retinal pigment epithelium cell barrier function (PubMed:25121097) . Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD (PubMed:24743736) .

Type

Protein

Source

E.coli

Sequence

KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CASP14

Protein Name

Caspase-14

Gene Name URL

CASP14

Nucleotide Accession Number

NM_012114

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP1 shRNA (h) Lentiviral Particles
sc-39584-V 200 µL

IGFBP1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LCL3 Polyclonal Antibody
MBS7159901 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LCL3 Polyclonal Antibody

Sign In for Pricing
View Details
CK7 Mouse Monoclonal Antibody (PE-Cy5.5)
orb970257 100 µL

CK7 Mouse Monoclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Human D-Dimer Matched Antibody Pair Set [ABP-S-05101]
ABP-S-05101 5 Plates

Human D-Dimer Matched Antibody Pair Set [ABP-S-05101]

Sign In for Pricing
View Details
Anti-RALGAPB Antibody Picoband® Biotin Conjugated
A14717-1-Biotin 100 µg/Vial

Anti-RALGAPB Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal 14-3-3 zeta/beta Antibody (3J3J9)
NBP3-16769-100ul 100 µL

Rabbit Monoclonal 14-3-3 zeta/beta Antibody (3J3J9)

Sign In for Pricing
View Details