Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonic anhydrase 2

Gene Aliases

CAC; CAII; CA-II; Car2; carbonate dehydratase II; carbonic anhydrase 2; carbonic anhydrase B; carbonic anhydrase C; carbonic anhydrase II; carbonic dehydratase; epididymis luminal protein 76; epididymis secretory protein Li 282; HEL-76; HEL-S-282.

Gene ID

760

Accession Number

NP_000058

Reactivity

Homo sapiens|Human

Target

Essential for bone resorption and osteoclast differentiation (By similarity) . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.

Type

Protein

Source

E.coli

Sequence

SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CA2

Protein Name

Carbonic anhydrase 2

Gene Name URL

CA2

Nucleotide Accession Number

NM_000067

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTM1 Antibody (C-term)
MBS9202457-01 0.08 mL

MTM1 Antibody (C-term)

Sign In for Pricing
View Details
MTM1 Antibody (C-term)
MBS9202457-02 0.4 mL

MTM1 Antibody (C-term)

Sign In for Pricing
View Details
MTM1 Antibody (C-term)
MBS9202457-03 5x 0.4 mL

MTM1 Antibody (C-term)

Sign In for Pricing
View Details
Mouse IL-6 ELISA Kit
NR-E10596-01 96 Tests

Mouse IL-6 ELISA Kit

Sign In for Pricing
View Details
Mouse IL-6 ELISA Kit
NR-E10596-02 96 Tests

Mouse IL-6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human PALLD Protein, N-His-SUMO & C-Strep
orb2834139-01 20 µg

Recombinant Human PALLD Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details