Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonic anhydrase 2

Gene Aliases

CAC; CAII; CA-II; Car2; carbonate dehydratase II; carbonic anhydrase 2; carbonic anhydrase B; carbonic anhydrase C; carbonic anhydrase II; carbonic dehydratase; epididymis luminal protein 76; epididymis secretory protein Li 282; HEL-76; HEL-S-282.

Gene ID

760

Accession Number

NP_000058

Reactivity

Homo sapiens|Human

Target

Essential for bone resorption and osteoclast differentiation (By similarity) . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.

Type

Protein

Source

E.coli

Sequence

SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CA2

Protein Name

Carbonic anhydrase 2

Gene Name URL

CA2

Nucleotide Accession Number

NM_000067

More Discoveries

Explore Other Products

Browse additional items from our catalog

pENTR223-GIMAP2 vector Plasmid
PVT11951 2 µg

pENTR223-GIMAP2 vector Plasmid

Sign In for Pricing
View Details
Spiramycin Rapid Test Kit
100031 96 Tests

Spiramycin Rapid Test Kit

Sign In for Pricing
View Details
TP53INP2 Antibody
OM636287-01 100 µL

TP53INP2 Antibody

Sign In for Pricing
View Details
TP53INP2 Antibody
OM636287-02 20 µL

TP53INP2 Antibody

Sign In for Pricing
View Details
TP53INP2 Antibody
OM636287-03 50 µL

TP53INP2 Antibody

Sign In for Pricing
View Details
LRPPRC Rabbit pAb
E45R25225N 50 ul

LRPPRC Rabbit pAb

Sign In for Pricing
View Details