Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA1 Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonic anhydrase 1

Gene Aliases

Ca1; CA-I; Carbonate dehydratase I; carbonic anhydrase 1; carbonic anhydrase I.

Gene ID

310218

Accession Number

NP_001101130

Reactivity

Rat|Rattus norvegicus

Target

Reversible hydration of carbon dioxide.

Type

Protein

Source

E.coli

Sequence

ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Car1

Protein Name

Carbonic anhydrase 1

Gene Name URL

Car1

Nucleotide Accession Number

NM_001107660

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-03 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-05 0.02 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)
MBS1025964-06 0.02 mg (Mammalian-Cell)

Recombinant Saccharomyces cerevisiae Suppressor of disruption of TFIIS (SDT1)

Sign In for Pricing
View Details