Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDNF Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Brain derived neurotrophic factor

Gene Aliases

Abrineurin; ANON2; brain-derived neurotrophic factor; BULN2; neurotrophin.

Gene ID

627

Accession Number

NP_001137277

Reactivity

Homo sapiens|Human

Target

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Type

Protein

Source

E.coli

Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BDNF

Protein Name

Brain-derived neurotrophic factor

Gene Name URL

BDNF

Nucleotide Accession Number

NM_001143805

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Centromere protein M (CENPM) ELISA Kit
MBS7201764-01 48 Well

Sheep Centromere protein M (CENPM) ELISA Kit

Sign In for Pricing
View Details
Sheep Centromere protein M (CENPM) ELISA Kit
MBS7201764-02 96 Well

Sheep Centromere protein M (CENPM) ELISA Kit

Sign In for Pricing
View Details
Sheep Centromere protein M (CENPM) ELISA Kit
MBS7201764-03 5x 96 Well

Sheep Centromere protein M (CENPM) ELISA Kit

Sign In for Pricing
View Details
Sheep Centromere protein M (CENPM) ELISA Kit
MBS7201764-04 10x 96 Well

Sheep Centromere protein M (CENPM) ELISA Kit

Sign In for Pricing
View Details
FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (FITC)
MBS6475656-01 0.2 mL

FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (FITC)

Sign In for Pricing
View Details
FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (FITC)
MBS6475656-02 5x 0.2 mL

FABP3, NT (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (FITC)

Sign In for Pricing
View Details