What is the catalog number for AQP1 Recombinant Protein (Human)?

The catalog number for AQP1 Recombinant Protein (Human) is OPCA03800-20UG.

What sizes are available for AQP1 Recombinant Protein (Human)?

AQP1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is AQP1 Recombinant Protein (Human) in stock?

AQP1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

AQP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Aquaporin 1 (Colton blood group)

Gene Aliases

AQP-CHIP; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group) ; aquaporin 1, Colton blood group antigen; aquaporin-1; aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP28; CO; Colton blood group antigen; urine water channel; water channel protein for red blood cells and kidney proximal tubule.

Gene ID

358

Accession Number

NP_932766

Reactivity

Homo sapiens|Human

Target

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Type

Protein

Source

E.coli

Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.