Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Aquaporin 1 (Colton blood group)

Gene Aliases

AQP-CHIP; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group) ; aquaporin 1, Colton blood group antigen; aquaporin-1; aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP28; CO; Colton blood group antigen; urine water channel; water channel protein for red blood cells and kidney proximal tubule.

Gene ID

358

Accession Number

NP_932766

Reactivity

Homo sapiens|Human

Target

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Type

Protein

Source

E.coli

Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AQP1

Protein Name

Aquaporin-1

Gene Name URL

AQP1

Nucleotide Accession Number

NM_198098

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smarca4 Rabbit Monoclonal Antibody [Clone ID: R07-4B7]
TA421986 100 µL

Smarca4 Rabbit Monoclonal Antibody [Clone ID: R07-4B7]

Sign In for Pricing
View Details
Prkcz, NT (Prkcz, Pkcz, Protein kinase C zeta type, nPKC-zeta) (PE) discontinued
040454-PE 200 µL

Prkcz, NT (Prkcz, Pkcz, Protein kinase C zeta type, nPKC-zeta) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ITIH3 Antibody [Alexa Fluor 750]
NBP2-97601AF750 0.1 mL

Rabbit Polyclonal ITIH3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Lentiviral mouse Slc16a6 shRNA (UAS) - Lentiviral mouse Slc16a6 shRNA (UAS) (25)
GTR15216077 1 Vial

Lentiviral mouse Slc16a6 shRNA (UAS) - Lentiviral mouse Slc16a6 shRNA (UAS) (25)

Sign In for Pricing
View Details
Phospho-PAK7/PAK6 (Ser602/Ser560) Antibody
A49668-100UL 100 µL

Phospho-PAK7/PAK6 (Ser602/Ser560) Antibody

Sign In for Pricing
View Details
STAT5B discontinued
514642 100 µg

STAT5B discontinued

Sign In for Pricing
View Details