Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Apolipoprotein C2

Gene Aliases

APOC-II; APO-CII; Apolipoprotein C2; apolipoprotein C-II.

Gene ID

344

Accession Number

NP_000474

Reactivity

Homo sapiens|Human

Target

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.

Type

Protein

Source

E.coli

Sequence

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APOC2

Protein Name

Apolipoprotein C-II

Gene Name URL

APOC2

Nucleotide Accession Number

NM_000483

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: BU63]
SM1167PT 25 µg

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: BU63]

Sign In for Pricing
View Details
Dkk1 sgRNA CRISPR Lentivector set (Rat)
K6748101 3x 1.0 µg

Dkk1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
NOMO1, phosphorylated (Ser1205) (Nodal Modulator 1, pM5, PM5) (MaxLight 490) discontinued
N3019-30-ML490 100 µL

NOMO1, phosphorylated (Ser1205) (Nodal Modulator 1, pM5, PM5) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human DNAJB13 shRNA (UAS) - Lentiviral human DNAJB13 shRNA (UAS, GFP) plasmid
GTR15078442 1 Vial

Lentiviral human DNAJB13 shRNA (UAS) - Lentiviral human DNAJB13 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human/Mouse PIWIL1/HIWI Affinity Purified Polyclonal Ab
AF6548-SP 25 µg

Human/Mouse PIWIL1/HIWI Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Cattle Tumor necrosis factor α (TNF-α) Elisa Kit
EK760254 96 Well

Cattle Tumor necrosis factor α (TNF-α) Elisa Kit

Sign In for Pricing
View Details