Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Apolipoprotein C2

Gene Aliases

APOC-II; APO-CII; Apolipoprotein C2; apolipoprotein C-II.

Gene ID

344

Accession Number

NP_000474

Reactivity

Homo sapiens|Human

Target

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.

Type

Protein

Source

E.coli

Sequence

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APOC2

Protein Name

Apolipoprotein C-II

Gene Name URL

APOC2

Nucleotide Accession Number

NM_000483

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH1 (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) BSA & Azide Free (HRP)
MBS6266858-01 0.1 mL

NOTCH1 (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) BSA & Azide Free (HRP)

Sign In for Pricing
View Details
NOTCH1 (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) BSA & Azide Free (HRP)
MBS6266858-02 5x 0.1 mL

NOTCH1 (Notch Homolog Protein 1, hN1, Translocation-associated Notch Protein TAN-1) BSA & Azide Free (HRP)

Sign In for Pricing
View Details
ST3GAL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
45629126 3x 1.0µg DNA

ST3GAL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Tear-off 8-tube Mat, 0,2 ml, RP, SFGC, LM
B58009L-1 25 Plates/Box

Tear-off 8-tube Mat, 0,2 ml, RP, SFGC, LM

Sign In for Pricing
View Details
Adagrasib (MRTX849)
S8884-1g 1 g

Adagrasib (MRTX849)

Sign In for Pricing
View Details
Microphthalmia (Transcription Factor, MiTF) Control Peptide discontinued
M3891-04P 1 mg

Microphthalmia (Transcription Factor, MiTF) Control Peptide discontinued

Sign In for Pricing
View Details