Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIF1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Allograft inflammatory factor 1

Gene Aliases

AI607846; AIF-1; allograft inflammatory factor 1; D17H6S50; D17H6S50E; G1; Ib; Iba1; ionized calcium binding adapter molecule 1; Ionized calcium-binding adapter molecule 1; testis specific.

Gene ID

11629

Accession Number

NP_062340

Reactivity

Mouse|Mus musculus

Target

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Type

Protein

Source

E.coli

Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Aif1

Protein Name

Allograft inflammatory factor 1

Gene Name URL

Aif1

Nucleotide Accession Number

NM_019467

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD1a Antibody Picoband®, Dylight550 Conjugate
PA1875-Dylight550 100 µg

Anti-CD1a Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Human CC-chemokine receptor 1, CCR-1 ELISA Kit
MBS161831-01 48 Well

Human CC-chemokine receptor 1, CCR-1 ELISA Kit

Sign In for Pricing
View Details
Human CC-chemokine receptor 1, CCR-1 ELISA Kit
MBS161831-02 96 Well

Human CC-chemokine receptor 1, CCR-1 ELISA Kit

Sign In for Pricing
View Details
Human CC-chemokine receptor 1, CCR-1 ELISA Kit
MBS161831-03 5x 96 Well

Human CC-chemokine receptor 1, CCR-1 ELISA Kit

Sign In for Pricing
View Details
Human CC-chemokine receptor 1, CCR-1 ELISA Kit
MBS161831-04 10x 96 Well

Human CC-chemokine receptor 1, CCR-1 ELISA Kit

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Orange - 1000 un, DNase/RNase free - ABDOS
P10237O 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Orange - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details