Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Allograft inflammatory factor 1

Gene Aliases

AIF-1; allograft inflammatory factor 1; IBA1; interferon gamma responsive transcript; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; protein G1.

Gene ID

199

Accession Number

NP_001305899

Reactivity

Homo sapiens|Human

Target

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Type

Protein

Source

E.coli

Sequence

SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AIF1

Protein Name

Allograft inflammatory factor 1

Gene Name URL

AIF1

Nucleotide Accession Number

NM_001318970

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tensin 2 (TNS2) ELISA Kit
QY-E00276 96 Tests

Human Tensin 2 (TNS2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Acetoacetyl CoA synthetase Protein - (Dry Ice)
H00065985-P01-25ug 25 µg

Recombinant Human Acetoacetyl CoA synthetase Protein - (Dry Ice)

Sign In for Pricing
View Details
RTN4R sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42871111 3x 1.0 µg

RTN4R sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
NIPSNAP1 Antibody
orb1560192-01 50 µL

NIPSNAP1 Antibody

Sign In for Pricing
View Details
NIPSNAP1 Antibody
orb1560192-02 100 µL

NIPSNAP1 Antibody

Sign In for Pricing
View Details
NIPSNAP1 Antibody
orb1560192-03 200 µL

NIPSNAP1 Antibody

Sign In for Pricing
View Details