Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FANC Recombinant Protein (Escherichia coli)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

FanCK99 fimbrial protein

Reactivity

Escherichia coli

Immunogen

23-181aa

Target

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.

Type

Protein

Source

E.coli

Sequence

NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FANC

Protein Name

K99 fimbrial protein

Gene Name URL

FANC

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit
MBS7245300-01 48 Well

Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit

Sign In for Pricing
View Details
Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit
MBS7245300-02 96 Well

Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit

Sign In for Pricing
View Details
Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit
MBS7245300-03 5x 96 Well

Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit

Sign In for Pricing
View Details
Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit
MBS7245300-04 10x 96 Well

Porcine COP9 signalosome complex subunit 5 (COPS5) ELISA Kit

Sign In for Pricing
View Details
CYB5R3 (Cytochrome b5 Reductase 3, 0610016L08Rik, 2500002N19Rik, C85115, Dia-1, Dia1, WU:AL591952.1-001, WU:AL591952.1-002, WU:Cyb5r3, NADH-cytochrome b5 Reductase, Diaphorase 1, Diaphorase 1 (NADH) )
208103 100 µg

CYB5R3 (Cytochrome b5 Reductase 3, 0610016L08Rik, 2500002N19Rik, C85115, Dia-1, Dia1, WU:AL591952.1-001, WU:AL591952.1-002, WU:Cyb5r3, NADH-cytochrome b5 Reductase, Diaphorase 1, Diaphorase 1 (NADH) )

Sign In for Pricing
View Details
pCDNA3.1-3XHA-Arid5a-203 Plasmid
PVT32938 2 µg

pCDNA3.1-3XHA-Arid5a-203 Plasmid

Sign In for Pricing
View Details