What is the catalog number for SALL2 Recombinant Protein?

The catalog number for SALL2 Recombinant Protein is OPCA03669-20UG.

What sizes are available for SALL2 Recombinant Protein?

SALL2 Recombinant Protein is available in the following size(s): 20 µg.

Is SALL2 Recombinant Protein in stock?

SALL2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

SALL2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Spalt like transcription factor 2

Gene Aliases

COLB; HSAL2; p150 (Sal2) ; Sal-2; sal-like protein 2; zinc finger protein 795; zinc finger protein SALL2; zinc finger protein Spalt-2; ZNF795.

Gene ID

6297

Accession Number

NP_001278375.1

Reactivity

Homo sapiens|Human

Target

Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Type

Protein

Source

Mammalian Cells

Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.