Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Parathyroid hormone 1 receptor

Gene Aliases

Parathyroid hormone 1 receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related peptide receptor; parathyroid receptor; PTH; PTH/PTHr receptor; PTH/PTHrP type I receptor; PTH1 receptor; PTHR1.

Gene ID

397675

Accession Number

NP_999547.1

Reactivity

Porcine|Sus scrofa

Target

Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.

Type

Protein

Source

Mammalian Cells

Sequence

MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTH1R

Host or Source

Pig

Protein Name

Parathyroid hormone/parathyroid hormone-related peptide receptor

Gene Name URL

PTH1R

Nucleotide Accession Number

NM_214382.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRN3 ORF Vector (Human) (pORF)
ORF014344 1.0 µg DNA

RRN3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ZBTB25 (NM_006977) Human Over-expression Lysate
LC416294 20 µg

ZBTB25 (NM_006977) Human Over-expression Lysate

Sign In for Pricing
View Details
PPFIBP1 Blocking Peptide
33R-7081 100 ug

PPFIBP1 Blocking Peptide

Sign In for Pricing
View Details
Goat anti Human IgM mu chain (FITC)
43R-1623 1 mg

Goat anti Human IgM mu chain (FITC)

Sign In for Pricing
View Details
RGD1306772 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV657961 1.0 µg DNA

RGD1306772 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Heat shock 70 kDa protein 1A (HSP70-2/HSP70.2) ELISA Kit
MBS2614151-01 48 Well

Rabbit Heat shock 70 kDa protein 1A (HSP70-2/HSP70.2) ELISA Kit

Sign In for Pricing
View Details