Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KKLC1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cancer/testis antigen 83

Gene Aliases

Cancer/testis antigen 83; CXorf61; kita-kyushu lung cancer antigen 1; KKLC1; KK-LC-1.

Gene ID

203413

Accession Number

NP_001017978.1

Reactivity

Homo sapiens|Human

Type

Protein

Source

Mammalian Cells

Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CT83

Host or Source

Human

Protein Name

Kita-kyushu lung cancer antigen 1

Gene Name URL

CT83

Nucleotide Accession Number

NM_001017978.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSA (Total) Matched Antibody Pair Set [ABP-S-07324]
ABP-S-07324 5 Plates

Human PSA (Total) Matched Antibody Pair Set [ABP-S-07324]

Sign In for Pricing
View Details
Colon cancer tissue array with matched cancer adjacent tissue, including TNM and pathology grade, 18 cases/ 54 cores, replacing BC05023
BC05023a 1 Each

Colon cancer tissue array with matched cancer adjacent tissue, including TNM and pathology grade, 18 cases/ 54 cores, replacing BC05023

Sign In for Pricing
View Details
SLURP2 Human qPCR Template Standard (NM_177458)
HK212199 1 Kit

SLURP2 Human qPCR Template Standard (NM_177458)

Sign In for Pricing
View Details
1-Thio-b-D-glucose, Sodium Salt Dihydrate
MBS6079741-01 250 mg

1-Thio-b-D-glucose, Sodium Salt Dihydrate

Sign In for Pricing
View Details
1-Thio-b-D-glucose, Sodium Salt Dihydrate
MBS6079741-02 5x 250 mg

1-Thio-b-D-glucose, Sodium Salt Dihydrate

Sign In for Pricing
View Details
Anti-Fruit fly CG7611 Antibody, Cy3 Conjugate
DZ41191-Cy3 200 µL/Vial

Anti-Fruit fly CG7611 Antibody, Cy3 Conjugate

Sign In for Pricing
View Details