Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KKLC1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cancer/testis antigen 83

Gene Aliases

Cancer/testis antigen 83; CXorf61; kita-kyushu lung cancer antigen 1; KKLC1; KK-LC-1.

Gene ID

203413

Accession Number

NP_001017978.1

Reactivity

Homo sapiens|Human

Type

Protein

Source

Mammalian Cells

Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CT83

Host or Source

Human

Protein Name

Kita-kyushu lung cancer antigen 1

Gene Name URL

CT83

Nucleotide Accession Number

NM_001017978.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 550)
MBS6348843-01 0.1 mL

SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 550)

Sign In for Pricing
View Details
SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 550)
MBS6348843-02 5x 0.1 mL

SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 550)

Sign In for Pricing
View Details
RGD1563441 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6032807 1.0 µg DNA

RGD1563441 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
JAM-C (Junctional Adhesion Molecule C, JAM-2, Junctional Adhesion Molecule 3, JAM-3) (MaxLight 550) discontinued
029520-ML550 100 µL

JAM-C (Junctional Adhesion Molecule C, JAM-2, Junctional Adhesion Molecule 3, JAM-3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
RBMXP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV773599 1.0 µg DNA

RBMXP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
SNRPD3 (N-Term) Rabbit pAb
MBS8551722-01 0.1 mL

SNRPD3 (N-Term) Rabbit pAb

Sign In for Pricing
View Details