What is the catalog number for LILRA5 Recombinant Protein?

The catalog number for LILRA5 Recombinant Protein is OPCA03651-20UG.

What sizes are available for LILRA5 Recombinant Protein?

LILRA5 Recombinant Protein is available in the following size(s): 20 µg.

Is LILRA5 Recombinant Protein in stock?

LILRA5 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

LILRA5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Leukocyte immunoglobulin like receptor A5

Gene Aliases

CD85; CD85 antigen-like family member F; CD85F; ILT11; ILT-11; Immunoglobulin-like transcript 11; immunoglobulin-like transcript 11 protein; leucocyte Ig-like receptor A5; leukocyte Ig-like receptor 9; leukocyte immunoglobulin-like receptor 9; leukocyte immunoglobulin-like receptor subfamily A member 5; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; LILRB7; LIR9; LIR-9.

Gene ID

353514

Accession Number

NP_067073.1

Reactivity

Homo sapiens|Human

Target

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Type

Protein

Source

Mammalian Cells

Sequence

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.