Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Leukocyte immunoglobulin like receptor A5

Gene Aliases

CD85; CD85 antigen-like family member F; CD85F; ILT11; ILT-11; Immunoglobulin-like transcript 11; immunoglobulin-like transcript 11 protein; leucocyte Ig-like receptor A5; leukocyte Ig-like receptor 9; leukocyte immunoglobulin-like receptor 9; leukocyte immunoglobulin-like receptor subfamily A member 5; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; LILRB7; LIR9; LIR-9.

Gene ID

353514

Accession Number

NP_067073.1

Reactivity

Homo sapiens|Human

Target

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Type

Protein

Source

Mammalian Cells

Sequence

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LILRA5

Host or Source

Human

Protein Name

Leukocyte immunoglobulin-like receptor subfamily A member 5

Gene Name URL

LILRA5

Nucleotide Accession Number

NM_021250.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTY Antibody
MBS9630106-01 0.1 mL

UTY Antibody

Sign In for Pricing
View Details
UTY Antibody
MBS9630106-02 0.2 mL

UTY Antibody

Sign In for Pricing
View Details
UTY Antibody
MBS9630106-03 5x 0.2 mL

UTY Antibody

Sign In for Pricing
View Details
Rabbit anti-DDX24 Antibody
DL92893A-01 50 µL

Rabbit anti-DDX24 Antibody

Sign In for Pricing
View Details
Rabbit anti-DDX24 Antibody
DL92893A-02 100 µL

Rabbit anti-DDX24 Antibody

Sign In for Pricing
View Details
Dpcr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3564205 3x 1.0 µg

Dpcr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details