Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Surfactant protein C

Gene Aliases

BRICD6; BRICHOS domain containing 6; PSP-C; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated protein C; pulmonary surfactant-associated proteolipid SPL (Val) ; SFTP2; SMDP2; SP5; SP-C.

Gene ID

6440

Accession Number

NP_001165828.1

Reactivity

Homo sapiens|Human

Target

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Type

Protein

Source

Mammalian Cells

Sequence

FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

7.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SFTPC

Host or Source

Human

Protein Name

Pulmonary surfactant-associated protein C

Gene Name URL

SFTPC

Nucleotide Accession Number

NM_001172357.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbx1 siRNA Oligos set (Mouse)
38722174 3x 5 nmol

Rbx1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)
MBS2065585-01 0.1 mL

APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)
MBS2065585-02 0.2 mL

APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)
MBS2065585-03 0.5 mL

APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)
MBS2065585-04 1 mL

APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)
MBS2065585-05 5 mL

APC-Linked Polyclonal Antibody to Chimerin 2 (CHN2)

Sign In for Pricing
View Details