What is the catalog number for IL-8 Recombinant Protein?

The catalog number for IL-8 Recombinant Protein is OPCA03639-100UG.

What sizes are available for IL-8 Recombinant Protein?

IL-8 Recombinant Protein is available in the following size(s): 100 µg.

Is IL-8 Recombinant Protein in stock?

IL-8 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

IL-8 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 8

Gene Aliases

Chemokine (C-X-C motif) ligand 8; C-X-C motif chemokine 8; IL8; IL-8; interleukin-8.

Gene ID

403850

Accession Number

NP_001003200.1

Reactivity

Canis lupus|Dog

Target

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Type

Protein

Source

Mammalian Cells

Sequence

AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.