Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPO Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Erythropoietin

Gene Aliases

Erythropoietin.

Gene ID

397249

Accession Number

NP_999299.1

Reactivity

Porcine|Sus scrofa

Target

Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Type

Protein

Source

Mammalian Cells

Sequence

APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EPO

Host or Source

Pig

Protein Name

Erythropoietin

Gene Name URL

EPO

Nucleotide Accession Number

NM_214134.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX56, CT (DDX56, DDX21, NOH61, Probable ATP-dependent RNA helicase DDX56, ATP-dependent 61kD nucleolar RNA helicase, DEAD box protein 21, DEAD box protein 56) (MaxLight 750) discontinued
034562-ML750 100 µL

DDX56, CT (DDX56, DDX21, NOH61, Probable ATP-dependent RNA helicase DDX56, ATP-dependent 61kD nucleolar RNA helicase, DEAD box protein 21, DEAD box protein 56) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPS6KB1 Antibody
A40303-100UG 100 µg

RPS6KB1 Antibody

Sign In for Pricing
View Details
Sheep Pg ELISA Kit
E106774 1 Each

Sheep Pg ELISA Kit

Sign In for Pricing
View Details
PE anti-human CD198 (CCR8)
GT14650 25 Tests

PE anti-human CD198 (CCR8)

Sign In for Pricing
View Details
Mcl 1 (Myeloid Cell Leukemia 1, MCL1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl-2-like Protein 3, BCL2L3, Bcl2-L-3, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC1839, MGC104264, Myeloid Cell Leukemia Sequence 1, TM) (MaxLight 490)
M2749-01C-ML490 100 µL

Mcl 1 (Myeloid Cell Leukemia 1, MCL1, Mcl-1, Bcl 2 Related Protein EAT/Mcl1, Bcl-2-like Protein 3, BCL2L3, Bcl2-L-3, EAT, Induced Myeloid Leukemia Cell Differentiation Protein, Mcl1/EAT, MCL1L, MCL1S, MGC1839, MGC104264, Myeloid Cell Leukemia Sequence 1, TM) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Clostridium phytofermentans UPF0178 protein Cphy_3042 (Cphy_3042)
MBS1109258-01 0.02 mg (E-Coli)

Recombinant Clostridium phytofermentans UPF0178 protein Cphy_3042 (Cphy_3042)

Sign In for Pricing
View Details