Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNDC5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibronectin type III domain containing 5

Gene Aliases

Fibronectin type III domain-containing protein 5; fibronectin type III repeat-containing protein 2; FRCP2; irisin.

Gene ID

252995

Accession Number

NP_001165411.2

Reactivity

Homo sapiens|Human

Target

Irisin: Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.

Type

Protein

Source

E.coli

Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FNDC5

Host or Source

Human

Protein Name

Fibronectin type III domain-containing protein 5

Gene Name URL

FNDC5

Nucleotide Accession Number

NM_001171940.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPZ2 sgRNA CRISPR Lentivector set (Human)
K0490101 3x 1.0 µg

COPZ2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit
MBS2886656-01 48 Well

Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit
MBS2886656-02 96 Well

Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit
MBS2886656-03 5x 96 Well

Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit
MBS2886656-04 10x 96 Well

Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Agxt protein
orb246289-01 20 µg

Mouse Agxt protein

Sign In for Pricing
View Details