Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pmp20 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Allergen Asp F3

Gene Aliases

Afu6g02280; AFUA_6G02280; allergen Asp F3; Thioredoxin peroxidase.

Gene ID

3505266

Accession Number

XP_747849.1

Reactivity

Aspergillus fumigatus|Neosartorya fumigata

Target

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Required for virulence.

Type

Protein

Source

E.coli

Sequence

MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AFUA_6G02280

Host or Source

Neosartorya fumigata

Protein Name

Peroxiredoxin Asp f3

Gene Name URL

AFUA_6G02280

Nucleotide Accession Number

XM_742756.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human M-CSF R Protein, His Tag (active enzyme)
CSR-H5543-100ug 100 µg

Human M-CSF R Protein, His Tag (active enzyme)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF647 conjugate, 0.1mg/mL
BNC471925-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [A4B3-R]
HA601260 100 µL

Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [A4B3-R]

Sign In for Pricing
View Details
SPDYE5 (N-term) Rabbit Polyclonal Antibody
AP54012PU-N 400 µL

SPDYE5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rpl27a (BC081430) Mouse Tagged ORF Clone
MG201013 10 µg

Rpl27a (BC081430) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS505847 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details