Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC48 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Plamsma membrane-associated AAA-ATPase

Gene Aliases

Cell division cycle protein 48 homolog; GLYMA_13G323600; valosin-containing protein homolog; VCP.

Gene ID

547850

Accession Number

NP_001235099.1

Reactivity

Glycine max

Target

Probably functions in cell division and growth processes.

Type

Protein

Source

E.coli

Sequence

DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDC48

Host or Source

Glycine max

Protein Name

Cell division cycle protein 48 homolog

Gene Name URL

CDC48

Nucleotide Accession Number

NM_001248170.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV753899 1.0 µg DNA

TRNAS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pramel (m) -PR
sc-143796-PR 10 µM - 20 µL

Pramel (m) -PR

Sign In for Pricing
View Details
CC-90009, Cereblon modulator/Molecular glue
TBI3922-5MG 5 mg

CC-90009, Cereblon modulator/Molecular glue

Sign In for Pricing
View Details
GSTM3, Recombinant, Human, His-Tag (Glutathione S-Transferase mu 3, GST5, GSTB, GSTM3-3, GTM3) discontinued. See 349962
301225 100 µg

GSTM3, Recombinant, Human, His-Tag (Glutathione S-Transferase mu 3, GST5, GSTB, GSTM3-3, GTM3) discontinued. See 349962

Sign In for Pricing
View Details
Csrnp2 (NM_153407) Mouse Tagged ORF Clone Lentiviral Particle
MR208558L3V 200 µL

Csrnp2 (NM_153407) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MHC Class I H-2 Kb / H-2 Db Mouse Monoclonal Antibody [Clone ID: 5041.16.1]
CL058F 100 µg

MHC Class I H-2 Kb / H-2 Db Mouse Monoclonal Antibody [Clone ID: 5041.16.1]

Sign In for Pricing
View Details