Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC48 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Plamsma membrane-associated AAA-ATPase

Gene Aliases

Cell division cycle protein 48 homolog; GLYMA_13G323600; valosin-containing protein homolog; VCP.

Gene ID

547850

Accession Number

NP_001235099.1

Reactivity

Glycine max

Target

Probably functions in cell division and growth processes.

Type

Protein

Source

E.coli

Sequence

DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDC48

Host or Source

Glycine max

Protein Name

Cell division cycle protein 48 homolog

Gene Name URL

CDC48

Nucleotide Accession Number

NM_001248170.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human S100A8 Polyclonal Antigen Affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3) (IHC)
IRBAMLS100A8AAP56200UL 1 Each

Rabbit Anti Human S100A8 Polyclonal Antigen Affinity Purified (PBS with 0.05% Proclin300, 50% glycerol, pH7.3) (IHC)

Sign In for Pricing
View Details
Mouse Keratin 5 (KRT5) ELISA Kit
YP-W23749-01 48 Tests

Mouse Keratin 5 (KRT5) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratin 5 (KRT5) ELISA Kit
YP-W23749-02 96 Tests

Mouse Keratin 5 (KRT5) ELISA Kit

Sign In for Pricing
View Details
DYRK1A, NT (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1A, Protein Kinase Minibrain Homolog, MNBH, HP86, Dual Specificity YAK1-related Kinase, hMNB, DYRK, MNB, MNBH) (PE) discontinued
D9904-02C-PE 200 µL

DYRK1A, NT (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1A, Protein Kinase Minibrain Homolog, MNBH, HP86, Dual Specificity YAK1-related Kinase, hMNB, DYRK, MNB, MNBH) (PE) discontinued

Sign In for Pricing
View Details
Mthfd1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4499207 1.0 µg DNA

Mthfd1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cox6a2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
16699116 3x 1.0 µg

Cox6a2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details