Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snaclec rhodocytin subunit beta Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aggretin beta chain; Rhodoaggretin subunit beta.

Reactivity

Calloselasma rhodostoma

Target

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Type

Protein

Source

Yeast

Sequence

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.4 kDa

Protein Length

Recombinant

Host or Source

Calloselasma rhodostoma

Protein Name

Snaclec rhodocytin subunit beta

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX9-set siRNA/shRNA/RNAi Lentivector (Human)
45582091 4x 500 ng

SSX9-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
BTN1A1 Knockout KYSE150 Polyclonal Cells
ARG36220 1 Million

BTN1A1 Knockout KYSE150 Polyclonal Cells

Sign In for Pricing
View Details
Gabazine 5mg
A12627-5 5 mg

Gabazine 5mg

Sign In for Pricing
View Details
Chicken Patatin Like Phospholipase Domain Containing Protein 3 (PNPLA3) ELISA Kit
GTR10358551 96 Well

Chicken Patatin Like Phospholipase Domain Containing Protein 3 (PNPLA3) ELISA Kit

Sign In for Pricing
View Details
ZBTB6 Antibody
C47232-01 50 μL

ZBTB6 Antibody

Sign In for Pricing
View Details
ZBTB6 Antibody
C47232-02 100 µL

ZBTB6 Antibody

Sign In for Pricing
View Details