Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snaclec rhodocytin subunit alpha Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aggretin alpha chain; Rhodoaggretin subunit alpha.

Reactivity

Calloselasma rhodostoma

Target

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Type

Protein

Source

Yeast

Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Notes

Formerly GWB-IGEEI0

Protein Length

Recombinant

Protein Name

Snaclec rhodocytin subunit alpha

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (FITC)
MBS6188067-01 0.1 mL

HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (FITC)

Sign In for Pricing
View Details
HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (FITC)
MBS6188067-02 5x 0.1 mL

HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (FITC)

Sign In for Pricing
View Details
SIGLEC1 Rabbit Polyclonal Antibody (PerCP)
orb2550005 100 µL

SIGLEC1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) (AP) discontinued
126270-AP 100 µL

ELAVL1 (Hu-antigen R, HuR, ELAV-like Protein 1, HUR) (AP) discontinued

Sign In for Pricing
View Details
CCDC71L Knockout NCI-H1975 Polyclonal Cells
ARG43059 1 Million

CCDC71L Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
DNAJC9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18421064 1.0 µg DNA

DNAJC9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details