Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snaclec rhodocytin subunit alpha Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aggretin alpha chain; Rhodoaggretin subunit alpha.

Reactivity

Calloselasma rhodostoma

Target

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Type

Protein

Source

Yeast

Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Notes

Formerly GWB-IGEEI0

Protein Length

Recombinant

Protein Name

Snaclec rhodocytin subunit alpha

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTWD1 Knockout MES-OV Polyclonal Cells
ARG39927 1 Million

DTWD1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Kif9 (NM_001163569) Mouse Tagged Lenti ORF Clone
MR216804L3 10 µg

Kif9 (NM_001163569) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit
MBS9399669-01 48 Well

Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit
MBS9399669-02 96 Well

Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit
MBS9399669-03 5x 96 Well

Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit
MBS9399669-04 10x 96 Well

Bovine Fibronectin Type III Domain Containing Protein 4 (FNDC4) ELISA Kit

Sign In for Pricing
View Details