Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snaclec rhodocytin subunit alpha Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aggretin alpha chain; Rhodoaggretin subunit alpha.

Reactivity

Calloselasma rhodostoma

Target

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Type

Protein

Source

Yeast

Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Notes

Formerly GWB-IGEEI0

Protein Length

Recombinant

Protein Name

Snaclec rhodocytin subunit alpha

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB6 (NM_173523) Human Over-expression Lysate
LY406453 100 µg

MAGEB6 (NM_173523) Human Over-expression Lysate

Sign In for Pricing
View Details
STX10 Antibody
CSB-PA225382-01 50 μL

STX10 Antibody

Sign In for Pricing
View Details
STX10 Antibody
CSB-PA225382-02 100 µL

STX10 Antibody

Sign In for Pricing
View Details
SLC15A5 Lentiviral Activation Particles (m)
sc-435508-LAC 200 µL

SLC15A5 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Probable ubiquinone biosynthesis monooxygenase coq-6 (coq-6)
MBS1119247-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Probable ubiquinone biosynthesis monooxygenase coq-6 (coq-6)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Probable ubiquinone biosynthesis monooxygenase coq-6 (coq-6)
MBS1119247-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Probable ubiquinone biosynthesis monooxygenase coq-6 (coq-6)

Sign In for Pricing
View Details