Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pru p 1.01 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Reactivity

Prunus dulcis x Prunus persica

Type

Protein

Source

E.coli

Sequence

MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRU P 1.01

Host or Source

Prunus dulcis x Prunus persica

Protein Name

Putative allergen Pru p 1.01

Gene Name URL

PRU P 1.01

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-1 Mapping Peptide Set
MBS154564-01 0.05 mg

PD-1 Mapping Peptide Set

Sign In for Pricing
View Details
PD-1 Mapping Peptide Set
MBS154564-02 5x 0.0 5mg

PD-1 Mapping Peptide Set

Sign In for Pricing
View Details
ANKS3 Blocking Peptide
33R-9953 0.1 mg

ANKS3 Blocking Peptide

Sign In for Pricing
View Details
C4ORF28 antibody
70R-4154 100 µL

C4ORF28 antibody

Sign In for Pricing
View Details
IGF1 Receptor Antibody
AF6124-01 100 µL

IGF1 Receptor Antibody

Sign In for Pricing
View Details
IGF1 Receptor Antibody
AF6124-02 200 µL

IGF1 Receptor Antibody

Sign In for Pricing
View Details