Pru p 1.01 Recombinant Protein
Product Specifications
CAS Number
9000-83-3
Reactivity
Prunus dulcis x Prunus persica
Type
Protein
Source
E.coli
Sequence
MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
33.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
PRU P 1.01
Host or Source
Prunus dulcis x Prunus persica
Protein Name
Putative allergen Pru p 1.01
Gene Name URL
PRU P 1.01
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
129468-ML550 100 µL
MBD5 (Methyl-CpG-binding Domain Protein 5, Methyl-CpG-binding Protein MBD5, KIAA1461, FLJ11113, FLJ30517) (MaxLight 550)
Sign In for Pricing
View Details VAng-Cr1306-500gEcoli 500 µg (E. coli)
Recombinant Treponema Pallidum rpsQ Protein (aa 1-84) (strain Nichols)
Sign In for Pricing
View Details E3375-11H-Biotin 200 µL
EGFR, phosphorylated (Tyr1125) (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) (Biotin) discontinued
Sign In for Pricing
View Details