Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MALD1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Mal d I.

Reactivity

Apple|Malus domestica

Type

Protein

Source

E.coli

Sequence

GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MALD1

Host or Source

Malus domestica

Protein Name

Major allergen Mal d 1

Gene Name URL

MALD1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic Interleukin 4 (IL4)
SFPA049Gu61-01 10 µg

Eukaryotic Interleukin 4 (IL4)

Sign In for Pricing
View Details
Eukaryotic Interleukin 4 (IL4)
SFPA049Gu61-02 50 µg

Eukaryotic Interleukin 4 (IL4)

Sign In for Pricing
View Details
Eukaryotic Interleukin 4 (IL4)
SFPA049Gu61-03 200 µg

Eukaryotic Interleukin 4 (IL4)

Sign In for Pricing
View Details
Eukaryotic Interleukin 4 (IL4)
SFPA049Gu61-04 1 mg

Eukaryotic Interleukin 4 (IL4)

Sign In for Pricing
View Details
Eukaryotic Interleukin 4 (IL4)
SFPA049Gu61-05 5 mg

Eukaryotic Interleukin 4 (IL4)

Sign In for Pricing
View Details
TXNDC11 Rabbit Polyclonal Antibody (Biotin)
orb445001 100 µL

TXNDC11 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details