Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Serine racemase

Gene Aliases

D-serine ammonia-lyase; D-serine dehydratase; ILV1; ISO1; L-serine ammonia-lyase; L-serine dehydratase; serine racemase.

Gene ID

63826

Reactivity

Homo sapiens|Human

Target

Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.

Type

Protein

Source

E.coli

Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRR

Host or Source

Human

Protein Name

Serine racemase

Gene Name URL

SRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r3d CRISPR Activation Plasmid (m)
sc-432830-ACT 20 µg

Ppp1r3d CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human Homeobox protein NANOG(NANOG)
AP73755-01 20 µg

Recombinant Human Homeobox protein NANOG(NANOG)

Sign In for Pricing
View Details
Recombinant Human Homeobox protein NANOG(NANOG)
AP73755-02 100 µg

Recombinant Human Homeobox protein NANOG(NANOG)

Sign In for Pricing
View Details
Recombinant Human Homeobox protein NANOG(NANOG)
AP73755-03 1 mg

Recombinant Human Homeobox protein NANOG(NANOG)

Sign In for Pricing
View Details
Recombinant Bartonella henselae Type IV secretion system protein virB2 (virB2), partial
MBS7101525 Inquire

Recombinant Bartonella henselae Type IV secretion system protein virB2 (virB2), partial

Sign In for Pricing
View Details
ACE (Angiotensin-Converting Enzyme, Angiotensin I Converting Enzyme)
474578 100 µL

ACE (Angiotensin-Converting Enzyme, Angiotensin I Converting Enzyme)

Sign In for Pricing
View Details