Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il1rl2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 1 receptor-like 2

Gene Aliases

AI481289; AW551444; IL1R-rp2; IL-1Rrp2; IL-36 receptor; interleukin-1 receptor related protein 2; interleukin-1 receptor-like 2; Interleukin-1 receptor-related protein 2.

Gene ID

107527

Accession Number

NP_573456.1

Reactivity

Mouse|Mus musculus

Target

Receptor for interleukin-36 (IL36A, IL36B and IL36G) . After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.

Type

Protein

Source

E.coli

Sequence

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Il1rl2

Host or Source

Mouse

Protein Name

Interleukin-1 receptor-like 2

Gene Name URL

Il1rl2

Nucleotide Accession Number

NM_133193.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CHRNA9 Antibody
CPA7267-01 30 µL

Anti-CHRNA9 Antibody

Sign In for Pricing
View Details
Anti-CHRNA9 Antibody
CPA7267-02 50 μL

Anti-CHRNA9 Antibody

Sign In for Pricing
View Details
Anti-CHRNA9 Antibody
CPA7267-03 100 µL

Anti-CHRNA9 Antibody

Sign In for Pricing
View Details
Anti-CHRNA9 Antibody
CPA7267-04 200 µL

Anti-CHRNA9 Antibody

Sign In for Pricing
View Details
Plant Lysophosphatidic Acid Receptor 1 (LPAR1) ELISA Kit
MBS9375271 Inquire

Plant Lysophosphatidic Acid Receptor 1 (LPAR1) ELISA Kit

Sign In for Pricing
View Details
Cpne8 (BC017626) Mouse Tagged Lenti ORF Clone
MR207010L4 10 µg

Cpne8 (BC017626) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details