Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JTB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

JTB, Protein JTB

Reactivity

Brugia malayi

Target

Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly (By similarity) .

Type

Protein

Source

E.coli

Sequence

EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

JTB

Host or Source

Brugia malayi

Protein Name

Protein JTB

Gene Name URL

JTB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4B (NM_020210) Human Recombinant Protein
TP316548 20 µg

SEMA4B (NM_020210) Human Recombinant Protein

Sign In for Pricing
View Details
CENPJ Mouse Monoclonal Antibody [Clone ID: OTI1E3]
CF811853 100 µg

CENPJ Mouse Monoclonal Antibody [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Hydrocortisone 17-Propionate 21-Acetate
TRC-H714628-50MG 50 mg

Hydrocortisone 17-Propionate 21-Acetate

Sign In for Pricing
View Details
CD10 Mouse Monoclonal Antibody [A1G3]
EM1901-24 100 µL

CD10 Mouse Monoclonal Antibody [A1G3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS706072 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
SGK (Ab-422) Antibody
8B0087-AAT 50 µg

SGK (Ab-422) Antibody

Sign In for Pricing
View Details