Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RC0497 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

N-acetylmuramoyl-L-alanine amidase

Gene Aliases

N-acetylmuramoyl-L-alanine amidase; RC_RS02530; RC0497.

Gene ID

928718

Accession Number

WP_004995964.1

Reactivity

Rickettsia conorii

Type

Protein

Source

E.coli

Sequence

MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RC_RS02530

Host or Source

Rickettsia conorii

Protein Name

Putative N-acetylmuramoyl-L-alanine amidase RC0497

Gene Name URL

RC_RS02530

Nucleotide Accession Number

NC_003103.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBE1, ID (GBE1, 1,4-alpha-glucan-branching enzyme, Brancher enzyme, Glycogen-branching enzyme) (Biotin) discontinued
035937-Biotin 200 µL

GBE1, ID (GBE1, 1,4-alpha-glucan-branching enzyme, Brancher enzyme, Glycogen-branching enzyme) (Biotin) discontinued

Sign In for Pricing
View Details
HDAC5 (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) (MaxLight 550)
MBS6479648-01 0.1 mL

HDAC5 (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) (MaxLight 550)

Sign In for Pricing
View Details
HDAC5 (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) (MaxLight 550)
MBS6479648-02 5x 0.1 mL

HDAC5 (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) (MaxLight 550)

Sign In for Pricing
View Details
Dynactin 3 CRISPR Activation Plasmid (h2)
sc-408827-ACT-2 20 µg

Dynactin 3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Dupd1 (NM_001108368) Rat Tagged ORF Clone Lentiviral Particle
RR208698L3V 200 µL

Dupd1 (NM_001108368) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LARP7 Polyclonal Antibody
RD81221A-01 60 μL

LARP7 Polyclonal Antibody

Sign In for Pricing
View Details