Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RnfH Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

RnfH, CbuG_0706, Protein RnfH

Reactivity

Coxiella burnetii

Type

Protein

Source

E.coli

Sequence

MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RNFH

Host or Source

Coxiella burnetii

Protein Name

Protein RnfH

Gene Name URL

RNFH

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNC 05-2090 hydrochloride
sc-204131 10 mg

NNC 05-2090 hydrochloride

Sign In for Pricing
View Details
HNF1A ELISA Kit (Human) (OKEH08105)
OKEH08105 96 Well

HNF1A ELISA Kit (Human) (OKEH08105)

Sign In for Pricing
View Details
SLAIN1 Blocking Peptide
33R-8203 0.1 mg

SLAIN1 Blocking Peptide

Sign In for Pricing
View Details
Adenovirus E1A Antibody Blocking Peptide
orb1503029 500 µg

Adenovirus E1A Antibody Blocking Peptide

Sign In for Pricing
View Details
ErbB-3 (phospho Tyr1197) Polyclonal Antibody
E20-60482 100 µg

ErbB-3 (phospho Tyr1197) Polyclonal Antibody

Sign In for Pricing
View Details
ZNF625 Antibody
MBS1492555-01 0.05 mg

ZNF625 Antibody

Sign In for Pricing
View Details