Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ClpP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

ATP-dependent Clp endopeptidase proteolytic subunit ClpP|ATP-dependent Clp protease proteolytic subunit

Gene Aliases

ATP-dependent Clp endopeptidase proteolytic subunit ClpP; CBO_RS15880; CBO3231; CLC_3142; Endopeptidase Clp.

Gene ID

5187372|5400447

Reactivity

Clostridium botulinum

Target

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Type

Protein

Source

E.coli

Sequence

MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ClpP

Host or Source

Clostridium botulinum

Protein Name

ATP-dependent Clp protease proteolytic subunit

Gene Name URL

ClpP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA (Proliferating Cell Nuclear antigen, MGC8367) (HRP)
249879-HRP 100 µL

PCNA (Proliferating Cell Nuclear antigen, MGC8367) (HRP)

Sign In for Pricing
View Details
Hamster Cathepsin L (CTSL) ELISA Kit
orb1173520-01 48 Tests

Hamster Cathepsin L (CTSL) ELISA Kit

Sign In for Pricing
View Details
Hamster Cathepsin L (CTSL) ELISA Kit
orb1173520-02 96 Tests

Hamster Cathepsin L (CTSL) ELISA Kit

Sign In for Pricing
View Details
KRAS G12C Ligand-Linker Conjugates 1
T212338-01 10 mg

KRAS G12C Ligand-Linker Conjugates 1

Sign In for Pricing
View Details
KRAS G12C Ligand-Linker Conjugates 1
T212338-02 50 mg

KRAS G12C Ligand-Linker Conjugates 1

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-6356 Vector
mm31248 500 ng

LentimiRa-Off-mmu-miR-6356 Vector

Sign In for Pricing
View Details