Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MecA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

MecA, MW0880Adapter protein MecA

Reactivity

Staphylococcus aureus

Target

Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis.

Type

Protein

Source

E.coli

Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MECA

Host or Source

Staphylococcus aureus

Protein Name

Adapter protein MecA

Gene Name URL

MECA

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-Off-hsa-miR-6783-3p Virus
mh7241 1.0 mL

AdmiRa-Off-hsa-miR-6783-3p Virus

Sign In for Pricing
View Details
Mouse Transthyretin (TTR) ELISA Kit
abx154802-01 96 Tests

Mouse Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Mouse Transthyretin (TTR) ELISA Kit
abx154802-02 5x 96 Tests

Mouse Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
Mouse Transthyretin (TTR) ELISA Kit
abx154802-03 10x 96 Tests

Mouse Transthyretin (TTR) ELISA Kit

Sign In for Pricing
View Details
PI-15 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11177R-BF594 100 µL

PI-15 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RN5S158 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV743730 1.0 µg DNA

RN5S158 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details