What is the catalog number for PrsA Recombinant Protein?

The catalog number for PrsA Recombinant Protein is OPCA03556-20UG.

What sizes are available for PrsA Recombinant Protein?

PrsA Recombinant Protein is available in the following size(s): 20 µg.

Is PrsA Recombinant Protein in stock?

PrsA Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

PrsA Recombinant Protein

Selected Variant

OPCA03556-20UG

Size: 20 µg

Product Specifications

CAS Number

9000-83-3

Gene Aliases

PrsA, SACOL1897, Foldase protein PrsA, EC 5.2.1.8

Accession Number

WP_000782121.1

Reactivity

Staphylococcus aureus

Target

Plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins.

Type

Protein

Source

E.coli

Sequence

CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRSA

Host or Source

Staphylococcus aureus

Protein Name

Foldase protein PrsA

Gene Name URL

PRSA

Nucleotide Accession Number

NC_002951.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF647 conjugate, 0.1mg/mL

BNC471317-500 1x 500 µL