Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Omega-5 gliadinImported Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Reactivity

Triticum aestivum|Wheat

Type

Protein

Source

E.coli

Sequence

QQQFPQQQSPQQQQFPQQQFPQQQQLPQKQFPQPQQIPQQQQIPQQPQQFPQQQFPQQQQFPQQQEFPQQQFPQQQFHQQQLPQQQFPQQQFPQQQFPQQQQFPQQQQLTQQQFPRPQQSPEQQQFPQQQFPQQPPQQFPQQQFPIPYPPQQSEEPSPYQQYPQQQPSGSDVISISGL

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.5 kDa

Protein Length

Recombinant

Host or Source

Triticum aestivum

Protein Name

Omega-5 gliadin

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human DEFB136 Protein
E30P12548 20 µg

Recombinant Human DEFB136 Protein

Ask
View Details
Cat Keratin 6C (KRT6C) ELISA Kit
MBS9917309 Inquire

Cat Keratin 6C (KRT6C) ELISA Kit

Ask
View Details
ATG4C (AUT Like 1 Cysteine Endopeptidase (S. Cerevisiae), APG4 Autophagy 4 Homolog C, Cysteine Protease ATG4C, APG4-C, Autophagy-Related Cysteine Endopeptidase 3, EC:3.4.22., ATG 4C, AUT Like 1, Cysteine Endopeptidase, EC 3.4.22, APG4C, Autophagin-3, OTTHUMP00000010715, AUTL3, APG4 Autophagy 4 Homolog C (S. Cerevisiae), Autophagy Related Cysteine Endopeptidase 3, ATG4C, Autophagin 3, ATG4 Autophagy Related 4 Homolog C, AUT Like 3 Cysteine Endopeptidase, AUTL1, ATG4C HUMAN, AUT (S. Cerevisiae) Like 1, Cysteine Endopeptidase, Autophagy-Related Protein 4 Homolog C, Autophagy Related Protein 4 Homolog C, ATG4 Autophagy Related 4 Homolog C (S. Cerevisiae), Autophagy Related 4C Cysteine Peptidase, Atg4c, APG4 C, FLJ14867, AUT-Like 3 Cysteine Endopeptidase) discontinued
384990 100 µg

ATG4C (AUT Like 1 Cysteine Endopeptidase (S. Cerevisiae), APG4 Autophagy 4 Homolog C, Cysteine Protease ATG4C, APG4-C, Autophagy-Related Cysteine Endopeptidase 3, EC:3.4.22., ATG 4C, AUT Like 1, Cysteine Endopeptidase, EC 3.4.22, APG4C, Autophagin-3, OTTHUMP00000010715, AUTL3, APG4 Autophagy 4 Homolog C (S. Cerevisiae), Autophagy Related Cysteine Endopeptidase 3, ATG4C, Autophagin 3, ATG4 Autophagy Related 4 Homolog C, AUT Like 3 Cysteine Endopeptidase, AUTL1, ATG4C HUMAN, AUT (S. Cerevisiae) Like 1, Cysteine Endopeptidase, Autophagy-Related Protein 4 Homolog C, Autophagy Related Protein 4 Homolog C, ATG4 Autophagy Related 4 Homolog C (S. Cerevisiae), Autophagy Related 4C Cysteine Peptidase, Atg4c, APG4 C, FLJ14867, AUT-Like 3 Cysteine Endopeptidase) discontinued

Ask
View Details
PARP1 discontinued
327541-01 50 µL

PARP1 discontinued

Ask
View Details
PARP1 discontinued
327541-02 100 µL

PARP1 discontinued

Ask
View Details
Atp5f1c Goat Polyclonal Antibody
TA329086 100 µg

Atp5f1c Goat Polyclonal Antibody

Ask
View Details