Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CD8a molecule

Gene Aliases

CD8; CD8 antigen, alpha polypeptide (p32) ; Leu2; Leu2 T-lymphocyte antigen; OKT8 T-cell antigen; p32; T cell co-receptor; T8 T-cell antigen; T-cell antigen Leu2; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2.

Gene ID

925

Accession Number

NP_001139345.1

Reactivity

Homo sapiens|Human

Target

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs) . In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs) . This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.

Type

Protein

Source

Yeast

Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CD8A

Host or Source

Human

Protein Name

T-cell surface glycoprotein CD8 alpha chain

Gene Name URL

CD8A

Nucleotide Accession Number

NM_001145873.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF647 conjugate, 0.1mg/mL
BNC471999-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin-11-dCTP, 1mM in pH 7.5 TE buffer
#40036 1x 50 µL

Biotin-11-dCTP, 1mM in pH 7.5 TE buffer

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF740 conjugate, 0.1mg/mL
BNC743074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710044 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
SEC14L1 (NM_003003) Human Over-expression Lysate
LY418958 100 µg

SEC14L1 (NM_003003) Human Over-expression Lysate

Sign In for Pricing
View Details
Snrpe (NM_009227) Mouse Tagged ORF Clone
MG200243 10 µg

Snrpe (NM_009227) Mouse Tagged ORF Clone

Sign In for Pricing
View Details