Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbs Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cystathionine beta-synthase

Gene Aliases

AI047524; AI303044; beta-thionase; cystathionine beta-synthase; HI; HIP4; serine sulfhydrase.

Gene ID

12411

Accession Number

NP_001258282.1

Reactivity

Mouse|Mus musculus

Target

Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity) . Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons (By similarity) .

Type

Protein

Source

Yeast

Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

63.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cbs

Host or Source

Mouse

Protein Name

Cystathionine beta-synthase

Gene Name URL

Cbs

Nucleotide Accession Number

NM_001271353.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV710692 1.0 µg DNA

GSTM3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human ICAM-1 ELISA kit
LF-EK50069 1×96T

Human ICAM-1 ELISA kit

Sign In for Pricing
View Details
OSB11 rabbit pAb
ES14367-01 50 µL

OSB11 rabbit pAb

Sign In for Pricing
View Details
OSB11 rabbit pAb
ES14367-02 100 µL

OSB11 rabbit pAb

Sign In for Pricing
View Details
Sheep Polyclonal Sheep anti-Rabbit IgG (H+L) Secondary Antibody [Janelia Fluor 549] (Pre-adsorbed)
NBP1-72740JF549 0.5 mg

Sheep Polyclonal Sheep anti-Rabbit IgG (H+L) Secondary Antibody [Janelia Fluor 549] (Pre-adsorbed)

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum Mflv_5248 Protein (aa 1-163)
VAng-Yyj4232-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Gilvum Mflv_5248 Protein (aa 1-163)

Sign In for Pricing
View Details