Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ypr-10 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Reactivity

Actinidia deliciosa

Type

Protein

Source

E.coli

Sequence

MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

YPR-10

Host or Source

Actinidia deliciosa

Protein Name

Bet v 1 related allergen

Gene Name URL

YPR-10

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)
MBS1471174-06 0.02 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana Uridine 5'-monophosphate synthase (PYRE-F)

Sign In for Pricing
View Details