Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

2S albuminImported Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Reactivity

Corylus avellana

Type

Protein

Source

E.coli

Sequence

FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

Host or Source

Corylus avellana

Protein Name

2S albumin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF699 Human Gene Knockout Kit (CRISPR)
KN423349 1 Kit

ZNF699 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MAD2L1 Binding Protein Antibody
RC-15434-01 50 μL

Recombinant MAD2L1 Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant MAD2L1 Binding Protein Antibody
RC-15434-02 100 µL

Recombinant MAD2L1 Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant MAD2L1 Binding Protein Antibody
RC-15434-03 1 mL

Recombinant MAD2L1 Binding Protein Antibody

Sign In for Pricing
View Details
Orbital Shaker BSOT-1604
BSOT-1604 1 Unit

Orbital Shaker BSOT-1604

Sign In for Pricing
View Details
rac-1,2-Distearoyl-3-chloropropanediol-d5
TRC-D493502-25MG 25 mg

rac-1,2-Distearoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details