Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fabp3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fatty acid binding protein 3

Gene Aliases

Fatty acid binding protein 3 heart; fatty acid binding protein 3, muscle and heart; Fatty acid-binding protein 3; fatty acid-binding protein, heart; heart fatty acid binding protein; heart-type fatty acid-binding protein; H-FABP.

Gene ID

79131

Accession Number

NP_077076.1

Reactivity

Rat|Rattus norvegicus

Target

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Type

Protein

Source

E.coli

Sequence

ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Fabp3

Host or Source

Rat

Protein Name

Fatty acid-binding protein, heart

Gene Name URL

Fabp3

Nucleotide Accession Number

NM_024162.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSARG1 Double Nickase Plasmid (m2)
sc-427608-NIC-2 20 µg

TSARG1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Phospho-GSK3A (Ser21) Rabbit Polyclonal Antibody (BF594)
orb2432534 100 µL

Phospho-GSK3A (Ser21) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Lentiviral mouse Rhd shRNA (UAS) - Lentiviral mouse Rhd shRNA (UAS, GFP) (100)
GTR15210201 1 Vial

Lentiviral mouse Rhd shRNA (UAS) - Lentiviral mouse Rhd shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Axin 2 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61459R-APC-Cy5.5 100 µL

Axin 2 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (HRP)
127141-HRP 100 µL

GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (HRP)

Sign In for Pricing
View Details
Mouse Enkephalin ELISA Kit (Ready to Use)
orb553954-01 48 Tests

Mouse Enkephalin ELISA Kit (Ready to Use)

Sign In for Pricing
View Details