Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LexA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA-binding transcriptional repressor LexA

Gene Aliases

B4043; DNA-binding transcriptional repressor LexA; ECK4035; exrA; spr; tsl; umuA.

Gene ID

948544

Accession Number

NP_418467.1

Reactivity

Escherichia coli

Target

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed:20005847) .The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed:22412352) .

Type

Protein

Source

E.coli

Sequence

MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LexA

Host or Source

Escherichia coli

Protein Name

LexA repressor

Gene Name URL

LexA

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIP1L1 Protein Vector (Mouse) (pPB-C-His)
PV179566 500 ng

FIP1L1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cdk9 (Phospho-Thr186) Polyclonal Antibody
MBS9413889-01 0.05 mL

Cdk9 (Phospho-Thr186) Polyclonal Antibody

Sign In for Pricing
View Details
Cdk9 (Phospho-Thr186) Polyclonal Antibody
MBS9413889-02 0.1 mL

Cdk9 (Phospho-Thr186) Polyclonal Antibody

Sign In for Pricing
View Details
Cdk9 (Phospho-Thr186) Polyclonal Antibody
MBS9413889-03 5x 0.1 mL

Cdk9 (Phospho-Thr186) Polyclonal Antibody

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF594 conjugate, 0.1mg/mL
BNC943179-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tomm40b Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV681136 1.0 µg DNA

Tomm40b Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details