Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LexA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA-binding transcriptional repressor LexA

Gene Aliases

B4043; DNA-binding transcriptional repressor LexA; ECK4035; exrA; spr; tsl; umuA.

Gene ID

948544

Accession Number

NP_418467.1

Reactivity

Escherichia coli

Target

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed:20005847) .The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed:22412352) .

Type

Protein

Source

E.coli

Sequence

MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LexA

Host or Source

Escherichia coli

Protein Name

LexA repressor

Gene Name URL

LexA

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2- (9H-carbazol-9-yl-d8) phenyl-3,4,5,6-d4) boronic acid
JH917867 1 Each

(2- (9H-carbazol-9-yl-d8) phenyl-3,4,5,6-d4) boronic acid

Sign In for Pricing
View Details
IL-1RII Lentiviral Activation Particles (m)
sc-421099-LAC 200 µL

IL-1RII Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rabbit Anti Human Caspase-3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200UL
IRBAMLCASP3AP72200UL 200 µL

Rabbit Anti Human Caspase-3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200UL

Sign In for Pricing
View Details
Olr773 Recombinant Protein (Rat)
RP218315 100 µg

Olr773 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CYP2R1 (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (APC)
125583-APC 100 µL

CYP2R1 (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (APC)

Sign In for Pricing
View Details
Pepsin 1:10000 ex. Porcine Stomach Mucosa extrapure AR, 2.5Anson U/mg
185075-01 25 g

Pepsin 1:10000 ex. Porcine Stomach Mucosa extrapure AR, 2.5Anson U/mg

Sign In for Pricing
View Details