Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Defb4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Defensin beta 4

Gene Aliases

2310001F05Rik; BD-4; beta-defensin 4; Defensin, beta 4.

Gene ID

56519

Accession Number

NP_062702.1

Reactivity

Mouse|Mus musculus

Target

Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells (PubMed:20068036) .

Type

Protein

Source

E.coli

Sequence

QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Defb4

Host or Source

Mouse

Protein Name

Beta-defensin 4

Gene Name URL

Defb4

Nucleotide Accession Number

NM_019728.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPHP1 Antibody, Biotin conjugated
A29922-50UG 50 µg

NPHP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DOCK11 CytoSection
TS416509P5 25 Slides

DOCK11 CytoSection

Sign In for Pricing
View Details
Olfr127 shRNA (m) Lentiviral Particles
sc-150427-V 200 µL

Olfr127 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Zea mays Cytochrome P450 71C2 (CYP71C2), partial
MBS7079766 Inquire

Recombinant Zea mays Cytochrome P450 71C2 (CYP71C2), partial

Sign In for Pricing
View Details
FADD, ID (FADD, MORT1, Protein FADD, Mediator of receptor induced toxicity, FAS-associated death domain protein, FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein) (MaxLight 405) discontinued
035335-ML405 100 µL

FADD, ID (FADD, MORT1, Protein FADD, Mediator of receptor induced toxicity, FAS-associated death domain protein, FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Nr4a1 (NM_010444) Mouse Tagged ORF Clone Lentiviral Particle
MR209316L1V 200 µL

Nr4a1 (NM_010444) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details