Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VACWR034 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Temporal expression: early

Gene Aliases

Interferon resistance protein; Protein K2; VACWR034.

Gene ID

3707649

Accession Number

YP_232916.1

Reactivity

Vaccinia Virus

Target

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Type

Protein

Source

Yeast

Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

K3L

Host or Source

Vaccinia virus

Protein Name

Protein K3

Gene Name URL

K3L

Nucleotide Accession Number

NC_006998.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse fibroblast growth factor-19,FGF-19 ELISA KIT
JOT-EK1645Mo-01 96 Well

Mouse fibroblast growth factor-19,FGF-19 ELISA KIT

Sign In for Pricing
View Details
Mouse fibroblast growth factor-19,FGF-19 ELISA KIT
JOT-EK1645Mo-02 48 Well

Mouse fibroblast growth factor-19,FGF-19 ELISA KIT

Sign In for Pricing
View Details
Bovine Epiregulin ELISA Kit
OM618314 96 Strip Well

Bovine Epiregulin ELISA Kit

Sign In for Pricing
View Details
Ppil4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6118202 1.0 µg DNA

Ppil4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
VAV2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61286R-BF555-01 20 µL

VAV2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
VAV2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61286R-BF555-02 100 µL

VAV2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details